Structure of PDB 3ice Chain C

Receptor sequence

>3iceC (length=413) Species: 83333 (Escherichia coli K-12)

MNLTELKNTPVSELITLGENLENLARMRKQDIIFAILKQHAKSGEDIFGD
GVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIR
PPKEGERYFALLKVNEVNFDKPENARNKILFENLTPLHANSRLRMERGNG
STEDLTARVLDLASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDC
VLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHVQVAEMVIEKAKR
LVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRFFG
AARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEK
RVFPAIDYNRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLINK
LAMTKTNDDFFEM

3D structure

• PDB: 3ice Running in reverse: the structural basis for translocation polarity in hexameric helicases.
• Chain: C
• Resolution: 2.8 Å

Enzymatic activity

• Enzyme Commision number: 3.6.4.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	K283 V284 L285 T286 G287 K326	K281 V282 L283 T284 G285 K324
BS02	ADP	C	R366 K367	R364 K365
BS03	BEF	C	G337 R366	G335 R364
BS04	ADP	C	K181 G183 K184 T185 M186 F355	K179 G181 K182 T183 M184 F353
BS05	BEF	C	K184 R212	K182 R210

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0004386 helicase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0008186 ATP-dependent activity, acting on RNA
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity
• GO:0042802 identical protein binding

Biological Process

• GO:0006353 DNA-templated transcription termination

Cellular Component

• GO:0005829 cytosol
• GO:0016020 membrane

External links

• PDB: RCSB:3ice, PDBe:3ice, PDBj:3ice
• PDBsum: 3ice
• PubMed: 19879839
• UniProt: P0AG30|RHO_ECOLI Transcription termination factor Rho (Gene Name=rho)