Structure of PDB 3ibg Chain C

Receptor sequence

>3ibgC (length=300)

LMEPTLQSILSQKTLRWIFVGGKGGVGKTTTSCSLAIQLAKVRKSVLLIS
TDPAHNLSDAFGQKFGKEARLVDGYSNLSAMEIDPNGSIQDLLASQDLAF
SIPGVDEAMSFAEVLKQVKSLSYEVIVFDTAPTGHTLRFLQFPTVLEKAL
AKLSQLSSQFSILGARGGLPGGQNIDELLQKMESLRETISEVNTQFKNPD
MTTFVCVCIAEFLSLYETERMIQELTSYGIDTHAIVVNQLLFPGCEQCNA
RRKMQKKYLEQIEELYEDFNVVRMPLLVEEVRGKEKLEKFSEMLVHPYVP

3D structure

• PDB: 3ibg Model for eukaryotic tail-anchored protein binding based on the structure of Get3
• Chain: C
• Resolution: 3.2 Å

Enzymatic activity

• Enzyme Commision number: 3.6.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	C	G36 G38 K39 T40 T41 N272 L314 L315 V319 R320	G25 G27 K28 T29 T30 N238 L276 L277 V281 R282

Gene Ontology

Molecular Function

• GO:0005085 guanyl-nucleotide exchange factor activity
• GO:0005524 ATP binding
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity
• GO:0042802 identical protein binding
• GO:0044183 protein folding chaperone
• GO:0046872 metal ion binding
• GO:0051082 unfolded protein binding

Biological Process

• GO:0000750 pheromone-dependent signal transduction involved in conjugation with cellular fusion
• GO:0006457 protein folding
• GO:0006620 post-translational protein targeting to endoplasmic reticulum membrane
• GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
• GO:0009408 response to heat
• GO:0010038 response to metal ion
• GO:0034599 cellular response to oxidative stress
• GO:0045048 protein insertion into ER membrane
• GO:0071816 tail-anchored membrane protein insertion into ER membrane

Cellular Component

• GO:0005737 cytoplasm
• GO:0005783 endoplasmic reticulum
• GO:0043529 GET complex

External links

• PDB: RCSB:3ibg, PDBe:3ibg, PDBj:3ibg
• PDBsum: 3ibg
• PubMed: 19706470
• UniProt: Q4WY07|GET3_ASPFU ATPase get3 (Gene Name=get3)