Structure of PDB 3hw6 Chain C

Receptor sequence

>3hw6C (length=175) Species: 93838 (Influenza A virus (A/goose/Guangdong/1/1996(H5N1)))

LGSMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFM
YSRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGV
TRREVHTYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIK
TRLFTIRQEMASRGLWDSFRQSERG

3D structure

• PDB: 3hw6 Nucleoside monophosphate complex structures of the endonuclease domain from the influenza virus polymerase PA subunit reveal the substrate binding site inside the catalytic center
• Chain: C
• Resolution: 2.5 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	C	H41 D108 E119 I120	H44 D86 E97 I98
BS02	MN	C	E80 D108	E58 D86

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0039694 viral RNA genome replication

External links

• PDB: RCSB:3hw6, PDBe:3hw6, PDBj:3hw6
• PDBsum: 3hw6
• PubMed: 19587036
• UniProt: Q9Q0U9|PA_I96A0 Polymerase acidic protein (Gene Name=PA)