Structure of PDB 3hrw Chain C

Receptor sequence

>3hrwC (length=141) Species: 10090 (Mus musculus)

VLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSH
GSAQVKGHGKKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKL
LSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSKYR

3D structure

• PDB: 3hrw Crystal structure of hemoglobin from mouse (Mus musculus) compared with those from other small animals and humans.
• Chain: C
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	Y42 F43 H45 H58 K61 V62 L66 L83 H87 L91 V93 N97 F98	Y42 F43 H45 H58 K61 V62 L66 L83 H87 L91 V93 N97 F98

Gene Ontology

Molecular Function

• GO:0005344 oxygen carrier activity
• GO:0005506 iron ion binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0001701 in utero embryonic development
• GO:0009617 response to bacterium
• GO:0015670 carbon dioxide transport
• GO:0015671 oxygen transport
• GO:0030185 nitric oxide transport
• GO:0035634 response to stilbenoid
• GO:0048821 erythrocyte development

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0043209 myelin sheath

External links

• PDB: RCSB:3hrw, PDBe:3hrw, PDBj:3hrw
• PDBsum: 3hrw
• PubMed: 33830076
• UniProt: P01942|HBA_MOUSE Hemoglobin subunit alpha (Gene Name=Hba)