Structure of PDB 3hdy Chain C

Receptor sequence

>3hdyC (length=349) Species: 1299 (Deinococcus radiodurans)

LIVGAGFAGSVLAERLASSGQRVLIVDRRPHIGGNAYDCYDDAGVLIHPY
GPHIFHTNSKDVFEYLSRFTEWRPYQHRVLASVDGQLLPIPINLDTVNRL
YGLNLTSFQVEEFFASVAEKVEQVRTSEDVVVSKVGRDLYNKFFRGYTRK
QWGLDPSELDASVTARVPTRTNRDNRYFADTYQAMPLHGYTRMFQNMLSS
PNIKVMLNTDYREIADFIPFQHMIYTGPVDAFFDFCYGKLPYRSLEFRHE
THDTEQLLPTGTVNYPNDYAYTRVSEFKHITGQRHHQTSVVYEYPRAEGD
PYYPVPRPENAELYKKYEALADAAQDVTFVGRLATYRYYNMDQVVAQAL

3D structure

• PDB: 3hdy Structural basis of substrate binding to UDP-galactopyranose mutase: crystal structures in the reduced and oxidized state complexed with UDP-galactopyranose and UDP.
• Chain: C
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R198 R202 R275 R305 E325 Y370 N372
• Catalytic site (residue number reindexed from 1): R166 R170 R243 R273 E293 Y338 N340
• Enzyme Commision number: 5.4.99.9: UDP-galactopyranose mutase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	C	G38 A40 D59 R60 R61 G66 N67 P84 H85 I86 D242 Y243 R364 Y371 N372 M373	G6 A8 D27 R28 R29 G34 N35 P52 H53 I54 D210 Y211 R332 Y339 N340 M341
BS02	GDU	C	H109 F175 F176 Y179 T180 W184 V195 R198 Y209 F210 N296 R305 Y335 Y370	H77 F143 F144 Y147 T148 W152 V163 R166 Y177 F178 N264 R273 Y303 Y338	MOAD: Kd=66uM

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0008767 UDP-galactopyranose mutase activity
• GO:0016853 isomerase activity
• GO:0050660 flavin adenine dinucleotide binding

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:3hdy, PDBe:3hdy, PDBj:3hdy
• PDBsum: 3hdy
• PubMed: 19836401
• UniProt: Q9RYF1