Structure of PDB 3h9j Chain C

Receptor sequence

>3h9jC (length=344) Species: 562 (Escherichia coli)

MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSS
YTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENNRYSRNFLHYQ
SYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQI
ENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDL
HKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLY
VPGKTGCYECQKVVGSEKENIDHKIKLINSRFKPATFAPVNNVAAALCAA
DVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGN

3D structure

• PDB: 3h9j How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
• Chain: C
• Resolution: 2.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R157
• Catalytic site (residue number reindexed from 1): R157

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	D214 H215 F217 V240 V245 N283 F286 R322 G324 W326 H333 Q335	D214 H215 F217 V240 V245 N279 F282 R318 G320 W322 H329 Q331
BS02	ZN	C	C257 C343 C346	C257 C339 C342
BS03	APC	C	G124 D146 N154 R157 Q158 K170 N193 I194 A213 D214 H215	G124 D146 N154 R157 Q158 K170 N193 I194 A213 D214 H215
BS04	APC	C	N193 H215 K287	N193 H215 K283

Gene Ontology

Molecular Function

• GO:0004792 thiosulfate sulfurtransferase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0008641 ubiquitin-like modifier activating enzyme activity
• GO:0016779 nucleotidyltransferase activity
• GO:0046872 metal ion binding

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3h9j, PDBe:3h9j, PDBj:3h9j
• PDBsum: 3h9j
• PubMed: 19494832
• UniProt: Q47506