Structure of PDB 3h6k Chain C

Receptor sequence
>3h6kC (length=260) Species: 9606 (Homo sapiens) [Search protein sequence]
NEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQK
VVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITN
TSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAG
KVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETA
MKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSR
KILEFLYSTS
3D structure
PDB3h6k Efficacious 11beta-hydroxysteroid dehydrogenase type I inhibitors in the diet-induced obesity mouse model.
ChainC
Resolution2.187 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) S170 Y183 K187
Catalytic site (residue number reindexed from 1) S147 Y160 K164
Enzyme Commision number 1.1.1.146: 11beta-hydroxysteroid dehydrogenase.
1.1.1.201: 7beta-hydroxysteroid dehydrogenase (NADP(+)).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAP C G41 S43 K44 I46 A65 R66 S67 T92 M93 N119 H120 I121 V168 S170 Y183 K187 L215 G216 L217 I218 T220 T222 A223 G18 S20 K21 I23 A42 R43 S44 T69 M70 N96 H97 I98 V145 S147 Y160 K164 L192 G193 L194 I195 T197 T199 A200
BS02 33T C L171 A172 Y177 Y183 G216 L217 L148 A149 Y154 Y160 G193 L194 MOAD: ic50=26nM
BindingDB: IC50=10nM
BS03 33T C Y280 S283 Y257 S260 MOAD: ic50=26nM
BindingDB: IC50=10nM
Gene Ontology
Molecular Function
GO:0005496 steroid binding
GO:0016491 oxidoreductase activity
GO:0042803 protein homodimerization activity
GO:0047022 7-beta-hydroxysteroid dehydrogenase (NADP+) activity
GO:0050661 NADP binding
GO:0070524 11-beta-hydroxysteroid dehydrogenase (NADP+) activity
GO:0102196 cortisol dehydrogenase activity
Biological Process
GO:0006706 steroid catabolic process
GO:0008202 steroid metabolic process
GO:0030324 lung development
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0016020 membrane
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3h6k, PDBe:3h6k, PDBj:3h6k
PDBsum3h6k
PubMed19673466
UniProtP28845|DHI1_HUMAN 11-beta-hydroxysteroid dehydrogenase 1 (Gene Name=HSD11B1)

[Back to BioLiP]