Structure of PDB 3gjq Chain C |
>3gjqC (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] |
NSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYE VRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPV DLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET |
|
PDB | 3gjq Caspase-3 binds diverse P4 residues in peptides as revealed by crystallography and structural modeling. |
Chain | C |
Resolution | 2.6 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
C |
R64 H121 C163 |
R30 H87 C129 |
|
|
|
|