Structure of PDB 3g6w Chain C

Receptor sequence
>3g6wC (length=207) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence]
PLYVIDKPITLHILTQLRDKYTDQINFRKNLVRLGRILGYEISNTLDYEI
VEVETPLGVKTKGVDITDLNNIVIINILRAAVPLVEGLLKAFPKARQGVI
GASRVKDMDVYIYYKKIPDIRAKVDNVIIADPMIATASTMLKVLEEVVKA
NPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGD
AGDRAFG
3D structure
PDB3g6w Structural and kinetic studies of the allosteric transition in Sulfolobus solfataricus uracil phosphoribosyltransferase: Permanent activation by engineering of the C-terminus
ChainC
Resolution2.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) R105 D116 D209 D212
Catalytic site (residue number reindexed from 1) R104 D107 D200 D203
Enzyme Commision number 2.4.2.9: uracil phosphoribosyltransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GTP C I26 K30 I25 K29
BS02 HSX C R105 D140 M142 A144 T145 A146 T148 R104 D131 M133 A135 T136 A137 T139
BS03 POP C R80 A103 R79 A102
BS04 GTP C K30 R34 K29 R33
BS05 GTP C R37 K91 P94 R36 K90 P93
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004422 hypoxanthine phosphoribosyltransferase activity
GO:0004845 uracil phosphoribosyltransferase activity
GO:0005525 GTP binding
GO:0016757 glycosyltransferase activity
Biological Process
GO:0006178 guanine salvage
GO:0006223 uracil salvage
GO:0008655 pyrimidine-containing compound salvage
GO:0032263 GMP salvage
GO:0032264 IMP salvage
GO:0044206 UMP salvage
GO:0046100 hypoxanthine metabolic process
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3g6w, PDBe:3g6w, PDBj:3g6w
PDBsum3g6w
PubMed19683539
UniProtQ980Q4|UPP_SACS2 Uracil phosphoribosyltransferase (Gene Name=upp)

[Back to BioLiP]