Structure of PDB 3g5i Chain C

Receptor sequence
>3g5iC (length=293) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
ALPILLDCDPGHDDAIAIVLALASPELDVKAITSSAGNQTPEKTLRNVLR
MLTLLNRTDIPVAGGAVKPLMRELGLDGPALPEPTFAPQNCTAVELMAKT
LRESAEPVTIVSTGPQTNVALLLNSHPELHSKIARIVIMGGAMGLGNWTP
AAEFNIYVDPEAAEIVFQSGIPVVMAGLDVTHKAQIHVEDTERFRAIGNP
VSTIVAELLDFEKWGFVGAPLHDPCTIAWLLKPELFTSVERWVGVETQGK
YTQGMTVVDYYYLTGNKPNATVMVDVDRQGFVDLLADRLKFYA
3D structure
PDB3g5i Active site plasticity revealed from the structure of the enterobacterial N-ribohydrolase RihA bound to a competitive inhibitor.
ChainC
Resolution2.1 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D10 D15 N39 L75 T124 F165 N166 H240 D241
Catalytic site (residue number reindexed from 1) D9 D14 N38 L74 T113 F154 N155 H222 D223
Enzyme Commision number 3.2.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA C D10 D15 T124 D241 D9 D14 T113 D223
BS02 DNB C D14 N39 M150 E164 N166 D241 D13 N38 M139 E153 N155 D223
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008477 purine nucleosidase activity
GO:0016798 hydrolase activity, acting on glycosyl bonds
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds
GO:0042802 identical protein binding
GO:0045437 uridine nucleosidase activity
GO:0050263 ribosylpyrimidine nucleosidase activity
Biological Process
GO:0006139 nucleobase-containing compound metabolic process
GO:0006152 purine nucleoside catabolic process
GO:0006206 pyrimidine nucleobase metabolic process
GO:0015949 nucleobase-containing small molecule interconversion
GO:0046133 pyrimidine ribonucleoside catabolic process
GO:0051289 protein homotetramerization
Cellular Component
GO:0005829 cytosol
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3g5i, PDBe:3g5i, PDBj:3g5i
PDBsum3g5i
PubMed20529317
UniProtP41409|RIHA_ECOLI Pyrimidine-specific ribonucleoside hydrolase RihA (Gene Name=rihA)

[Back to BioLiP]