Structure of PDB 3fye Chain C

Receptor sequence

>3fyeC (length=531) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

WFMSTNHKDIGVLYLFTGGLVGLISVAFTVYMRMELMAPGVQFMCAEHLE
SGLVKGFFQSLWPSAVENCTPNGHLWNVMITGHGILMMFFVVIPALFGGF
GNYFMPLHIGAPDMAFPRMNNLSYWLYVAGTSLAVASLFAPGGNGQLGSG
IGWVLYPPLSTSESGYSTDLAIFAVHLSGASSILGAINMITTFLNMRAPG
MTMHKVPLFAWSIFVTAWLILLALPVLAGAITMLLTDRNFGTTFFQPSGG
GDPVLYQHILWFFGHPEVYIIVLPAFGIVSHVIATFAKKPIFGYLPMVYA
MVAIGVLGFVVWAHHMYTAGLSLTQQSYFMMATMVIAVPTGIKIFSWIAT
MWGGSIELKTPMLWALGFLFLFTVGGVTGIVLSQASVDRYYHDTYYVVAH
FHYVMSLGAVFGIFAGIYFWIGKMSGRQYPEWAGKLHFWMMFVGANLTFF
PQHFLGRQGMPRRYIDYPEAFATWNFVSSLGAFLSFASFLFFLGVIFYTL
TRGARVTANNYWNEHADTLEWTLTSPPPEHT

3D structure

PDB

3fye Redox dependent conformational changes in cytochrome c oxidase suggest a gating mechanism for proton uptake.

Chain

Resolution

2.15 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	Y33 I43 F47 M51 I99 H102 N121 D132 N139 S142 Y146 W172 S200 S201 G204 T211 H284 E286 Y288 S299 P315 H333 H334 T359 K362 H419 F420 H421 R481
Catalytic site (residue number reindexed from 1)	Y14 I24 F28 M32 I80 H83 N102 D113 N120 S123 Y127 W153 S181 S182 G185 T192 H265 E267 Y269 S280 P296 H314 H315 T340 K343 H400 F401 H402 R462
Enzyme Commision number	7.1.1.9: cytochrome-c oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEA	C	G38 T48 M51 R52 W95 I99 H102 M106 M107 G171 W172 Y414 F420 H421 M424 S425 V429 I432 M460 F468 R482 S504 F508	G19 T29 M32 R33 W76 I80 H83 M87 M88 G152 W153 Y395 F401 H402 M405 S406 V410 I413 M441 F449 R463 S485 F489
BS02	HEA	C	W172 W280 V287 V291 H333 H334 G360 F364 F391 G395 V396 G398 L401 S402 D407 H411 V416 H419 F420 V423 M424 R481	W153 W261 V268 V272 H314 H315 G341 F345 F372 G376 V377 G379 L382 S383 D388 H392 V397 H400 F401 V404 M405 R462
BS03	CU1	C	H284 H333 H334	H265 H314 H315
BS04	MG	C	H411 D412	H392 D393
BS05	CA	C	E54 A57 G59 Q61	E35 A38 G40 Q42
BS06	DMU	C	Q61 S83 F502	Q42 S64 F483

Gene Ontology

	Molecular Function
GO:0004129	cytochrome-c oxidase activity
GO:0005515	protein binding
GO:0020037	heme binding
GO:0046872	metal ion binding

	Biological Process
GO:0006119	oxidative phosphorylation
GO:0009060	aerobic respiration
GO:0015990	electron transport coupled proton transport
GO:0022904	respiratory electron transport chain
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0045277	respiratory chain complex IV

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3fye, PDBe:3fye, PDBj:3fye
PDBsum	3fye
PubMed	19397279
UniProt	P33517\|COX1_CERSP Cytochrome c oxidase subunit 1 (Gene Name=ctaD)

[Back to BioLiP]