Structure of PDB 3fux Chain C

Receptor sequence

>3fuxC (length=265) Species: 300852 (Thermus thermophilus HB8)

LASPQSVRALLERHGLFADKRFGQNFLVSEAHLRRIVEAARPFTGPVFEV
GPGLGALTRALLEAGAEVTAIEKDLRLRPVLEETLSGLPVRLVFQDALLY
PWEEVPQGSLLVANLPYHIATPLVTRLLKTGRFARLVFLVQKEVAERMTA
RPKTPAYGVLTLRVAHHAVAERLFDLPPGAFFPPPKVWSSLVRLTPTGAL
DDPGLFRLVEAAFGKRRKTLLNALAAAGYPKARVEEALRALGLPPRVRAE
ELDLEAFRRLREGLE

3D structure

• PDB: 3fux Structural rearrangements in the active site of the Thermus thermophilus 16S rRNA methyltransferase KsgA in a binary complex with 5'-methylthioadenosine.
• Chain: C
• Resolution: 1.68 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): G54 E75 N117 Y120 F184
• Catalytic site (residue number reindexed from 1): G51 E72 N114 Y117 F181
• Enzyme Commision number: 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MTA	C	F25 G26 Q27 N28 G54 G56 E75 K76 D99 A100 N117 P119 H121	F22 G23 Q24 N25 G51 G53 E72 K73 D96 A97 N114 P116 H118

Gene Ontology

Molecular Function

• GO:0000179 rRNA (adenine-N6,N6-)-dimethyltransferase activity
• GO:0003723 RNA binding
• GO:0008168 methyltransferase activity
• GO:0016433 rRNA (adenine) methyltransferase activity
• GO:0052908 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase activity

Biological Process

• GO:0000154 rRNA modification
• GO:0006364 rRNA processing
• GO:0031167 rRNA methylation
• GO:0032259 methylation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:3fux, PDBe:3fux, PDBj:3fux
• PDBsum: 3fux
• PubMed: 19285505
• UniProt: Q5SM60|RSMA_THET8 Ribosomal RNA small subunit methyltransferase A (Gene Name=rsmA)