Structure of PDB 3fsw Chain C |
>3fswC (length=124) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
ECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLS TAADMQGVVTDGMASGDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKE GEQYMFFCAAAAHAAAMKGTLTLK |
|
PDB | 3fsw Metal-binding loop length and not sequence dictates structure. |
Chain | C |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
C |
H46 C112 H117 |
H45 C108 H113 |
|
|
|
|