Structure of PDB 3fga Chain C

Receptor sequence
>3fgaC (length=303) Species: 9606 (Homo sapiens) [Search protein sequence]
DEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCP
VTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVNRGYYSVETVTLLV
ALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFD
YLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWS
DPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWC
HDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRTRRTPD
YFL
3D structure
PDB3fga Structure and function of the PP2A-shugoshin interaction
ChainC
Resolution2.7 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D57 H59 D85 N88 R89 N117 H118 H167 R214 H241
Catalytic site (residue number reindexed from 1) D56 H58 D84 N87 R88 N116 H117 H166 R213 H240
Enzyme Commision number 3.1.3.16: protein-serine/threonine phosphatase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide C R89 Y127 P190 H191 W200 R214 Y265 C266 C269 R88 Y126 P189 H190 W199 R213 Y264 C265 C268
BS02 MN C D57 H59 D85 H118 D56 H58 D84 H117
BS03 MN C D85 N117 H167 H241 D84 N116 H166 H240
Gene Ontology
Molecular Function
GO:0004721 phosphoprotein phosphatase activity
GO:0004722 protein serine/threonine phosphatase activity
GO:0004725 protein tyrosine phosphatase activity
GO:0005515 protein binding
GO:0016787 hydrolase activity
GO:0017018 myosin phosphatase activity
GO:0046872 metal ion binding
GO:0046982 protein heterodimerization activity
GO:0048156 tau protein binding
GO:0050811 GABA receptor binding
Biological Process
GO:0000278 mitotic cell cycle
GO:0001932 regulation of protein phosphorylation
GO:0006470 protein dephosphorylation
GO:0007498 mesoderm development
GO:0010288 response to lead ion
GO:0010719 negative regulation of epithelial to mesenchymal transition
GO:0035331 negative regulation of hippo signaling
GO:0035556 intracellular signal transduction
GO:0035970 peptidyl-threonine dephosphorylation
GO:0040008 regulation of growth
GO:0043029 T cell homeostasis
GO:0045595 regulation of cell differentiation
GO:0051321 meiotic cell cycle
GO:0051898 negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0070262 peptidyl-serine dephosphorylation
GO:0071902 positive regulation of protein serine/threonine kinase activity
GO:1900227 positive regulation of NLRP3 inflammasome complex assembly
GO:1904526 regulation of microtubule binding
GO:1904528 positive regulation of microtubule binding
GO:1904539 negative regulation of glycolytic process through fructose-6-phosphate
GO:2000045 regulation of G1/S transition of mitotic cell cycle
Cellular Component
GO:0000159 protein phosphatase type 2A complex
GO:0000775 chromosome, centromeric region
GO:0000922 spindle pole
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0008287 protein serine/threonine phosphatase complex
GO:0015630 microtubule cytoskeleton
GO:0016020 membrane
GO:0045121 membrane raft
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:0090443 FAR/SIN/STRIPAK complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3fga, PDBe:3fga, PDBj:3fga
PDBsum3fga
PubMed19716788
UniProtP67775|PP2AA_HUMAN Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform (Gene Name=PPP2CA)

[Back to BioLiP]