Structure of PDB 3ez3 Chain C

Receptor sequence

>3ez3C (length=357) Species: 5855 (Plasmodium vivax)

LAFFRNMYDKYRDAFLSHLNEYSLEEEIKEHISKYYKLLFDYNCLGGKNN
RGILVILIYEYVKNINSSEWEKAACLAWCIEILQAAFLVADDIMDKGEMR
RNKYCWYLLKDVETKNAVNDVLLLYNSIYKLIEIYLRNESCYVDVIATFR
DATLKTIIGQHLDTNIFSDKYSEIDVNNINVPEQPVIDINMINFGVYKNI
VIHKTAYYSFFLPIVCGMLLAGIAVDNLIYKKIEDISMLMGEYFQIHDDY
LDIFGDSTKTGKVGSDIQNNKLTWPLIKTFELCSEPDKIKIVKNYGKNNL
ACVKVIDSLYEQYKIRKHYESYEKAQKAKILSAINELHHEGIEYVLKYLL
EILFTGV

3D structure

• PDB: 3ez3 Crystal Structure of Plasmodium vivax geranylgeranylpyrophosphate synthase PVX_092040 with zoledronate and IPP bound
• Chain: C
• Resolution: 2.304 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K81 A121 D126 D130 R135 D198 K243 F283 D287 D288
• Catalytic site (residue number reindexed from 1): K48 A86 D91 D95 R100 D163 K204 F244 D248 D249

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZOL	C	D126 R135 Q195 K243 T244 D287 K301	D91 R100 Q160 K204 T205 D248 K262
BS02	IPE	C	G80 K81 R84 Q119 R136 F283	G47 K48 R51 Q84 R101 F244
BS03	MG	C	D126 D130	D91 D95
BS04	MG	C	D126 D130	D91 D95

Gene Ontology

Molecular Function

• GO:0004161 dimethylallyltranstransferase activity
• GO:0004337 geranyltranstransferase activity
• GO:0004659 prenyltransferase activity
• GO:0016740 transferase activity
• GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
• GO:0046872 metal ion binding

Biological Process

• GO:0008299 isoprenoid biosynthetic process
• GO:0045337 farnesyl diphosphate biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0016020 membrane

External links

• PDB: RCSB:3ez3, PDBe:3ez3, PDBj:3ez3
• PDBsum: 3ez3
• UniProt: A5K4U6