Structure of PDB 3euf Chain C

Receptor sequence
>3eufC (length=294) Species: 9606 (Homo sapiens) [Search protein sequence]
DCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRM
KAFIRCVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSI
SIMLHELIKLLYYARCSNVTIIRIGTSGGIGLEPGTVVITEQAVDTCFKA
EFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYE
GQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQA
AVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSK
3D structure
PDB3euf Implications of the structure of human uridine phosphorylase 1 on the development of novel inhibitors for improving the therapeutic window of fluoropyrimidine chemotherapy.
ChainC
Resolution1.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) E121 R275
Catalytic site (residue number reindexed from 1) E106 R260
Enzyme Commision number 2.4.2.3: uridine phosphorylase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BAU C T141 S142 G143 F213 Q217 R219 I281 T126 S127 G128 F198 Q202 R204 I266 BindingDB: Kd=1200nM
BS02 PO4 C G60 R138 G140 T141 G45 R123 G125 T126
BS03 BAU C Y35 H36 Y20 H21 BindingDB: Kd=1200nM
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0004850 uridine phosphorylase activity
GO:0009032 thymidine phosphorylase activity
GO:0016757 glycosyltransferase activity
GO:0016763 pentosyltransferase activity
GO:0042802 identical protein binding
GO:0047847 deoxyuridine phosphorylase activity
Biological Process
GO:0006139 nucleobase-containing compound metabolic process
GO:0006218 uridine catabolic process
GO:0006220 pyrimidine nucleotide metabolic process
GO:0006248 CMP catabolic process
GO:0006249 dCMP catabolic process
GO:0009116 nucleoside metabolic process
GO:0009164 nucleoside catabolic process
GO:0009166 nucleotide catabolic process
GO:0042149 cellular response to glucose starvation
GO:0044206 UMP salvage
GO:0046050 UMP catabolic process
GO:0046074 dTMP catabolic process
GO:0046079 dUMP catabolic process
GO:0046108 uridine metabolic process
Cellular Component
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3euf, PDBe:3euf, PDBj:3euf
PDBsum3euf
PubMed19291308
UniProtQ16831|UPP1_HUMAN Uridine phosphorylase 1 (Gene Name=UPP1)

[Back to BioLiP]