Structure of PDB 3es9 Chain C

Receptor sequence
>3es9C (length=435) Species: 10116 (Rattus norvegicus) [Search protein sequence]
EASSIRQYELVVHEDMDVAKVYTGEMGRLKSYENQKPPFDAKNPFLAAVT
ANRKLNQGTERHLMHLELDISDSKIRYESGDHVAVYPANDSALVNQIGEI
LGADLDVIMSLNNLDEESNKKHPFPCPTTYRTALTYYLDITNPPRTNVLY
ELAQYASEPSEQEHLHKMASSSGEGKELYLSWVVEARRHILAILQDYPSL
RPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVAVEYEAKSGRVNK
GVATSWLRAKEPRALVPMFVRKSQFRLPFKSTTPVIMVGPGTGIAPFMGF
IQERAWLREQGKEVGETLLYYGCRRSDEDYLYREELARFHKDGALTQLNV
AFSREQAHKVYVQHLLKRDREHLWKLIHEGGAHIYVCGDARNMAKDVQNT
FYDIVAEFGPMEHTQAVDYVKKLMTKGRYSLDVWS
3D structure
PDB3es9 Structure and function of an NADPH-cytochrome P450 oxidoreductase in an open conformation capable of reducing cytochrome P450
ChainC
Resolution3.4 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) Y456 S457 C630 D675 W677
Catalytic site (residue number reindexed from 1) Y219 S220 C387 D432 W434
Enzyme Commision number 1.6.2.4: NADPH--hemoprotein reductase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FAD C R424 R454 Y455 Y456 S457 A473 V474 V476 Y478 G488 V489 A490 T491 T535 W677 R187 R217 Y218 Y219 S220 A236 V237 V239 Y241 G251 V252 A253 T254 T292 W434
Gene Ontology
Molecular Function
GO:0003958 NADPH-hemoprotein reductase activity
GO:0004128 cytochrome-b5 reductase activity, acting on NAD(P)H
GO:0008941 nitric oxide dioxygenase NAD(P)H activity
GO:0009055 electron transfer activity
GO:0010181 FMN binding
GO:0016491 oxidoreductase activity
GO:0016787 hydrolase activity
GO:0019899 enzyme binding
GO:0047726 iron-cytochrome-c reductase activity
GO:0050660 flavin adenine dinucleotide binding
GO:0050661 NADP binding
Biological Process
GO:0003420 regulation of growth plate cartilage chondrocyte proliferation
GO:0007584 response to nutrient
GO:0009410 response to xenobiotic stimulus
GO:0009437 carnitine metabolic process
GO:0009725 response to hormone
GO:0009812 flavonoid metabolic process
GO:0019395 fatty acid oxidation
GO:0022900 electron transport chain
GO:0032332 positive regulation of chondrocyte differentiation
GO:0043066 negative regulation of apoptotic process
GO:0043602 nitrate catabolic process
GO:0045542 positive regulation of cholesterol biosynthetic process
GO:0045880 positive regulation of smoothened signaling pathway
GO:0046210 nitric oxide catabolic process
GO:0070988 demethylation
GO:0071371 cellular response to gonadotropin stimulus
GO:0071372 cellular response to follicle-stimulating hormone stimulus
GO:0071375 cellular response to peptide hormone stimulus
GO:0071548 response to dexamethasone
GO:0090031 positive regulation of steroid hormone biosynthetic process
GO:0090181 regulation of cholesterol metabolic process
GO:0090346 cellular organofluorine metabolic process
Cellular Component
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol
GO:0016020 membrane
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3es9, PDBe:3es9, PDBj:3es9
PDBsum3es9
PubMed19171935
UniProtP00388|NCPR_RAT NADPH--cytochrome P450 reductase (Gene Name=Por)

[Back to BioLiP]