Structure of PDB 3eni Chain C

Receptor sequence

>3eniC (length=356) Species: 1097 (Chlorobaculum tepidum)

VTTAHSDYEIVLEGSSSWGKVKARAKVNAPPASPLLPADCDVKLNVKPLD
PAKGFVRISAVFESIVDSTKNKLTIEADIANETKERRISVGEGMVSVGDF
SHTFSFEGSVVNLFYYRSDAVRRNVPNPIYMQGRQFHDILMKVPLDNNDL
IDTWEGTVKAIGSTGAFNDWIRDFWFIGPAFTALNEGGQRISRIEVNGLN
TESGKGPVGVSRWRFSHGGSGMVDSISRWAELFPSDKLNRPAQVEAGFRS
DSQGIEVKVDGEFPGVSVDAGGGLRRILNHPLIPLVHHGMVGKFNNFNVD
AQLKVVLPKGYKIRYAAPQYRSQNLEEYRWSGGAYARWVEHVCKGGVGQF
EILYAQ

3D structure

• PDB: 3eni The structural basis for the difference in absorbance spectra for the FMO antenna protein from various green sulfur bacteria.
• Chain: C
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	C	Y15 V29 L287 H289 P290 P293 H297 Y344 W347 F359	Y8 V21 L278 H280 P281 P284 H288 Y335 W338 F350
BS02	BCL	C	F70 R237 L241 F242 P243 P273 P290	F62 R228 L232 F233 P234 P264 P281
BS03	BCL	C	V105 F108 H110 F112 V151 L158 T161 W162 T165 F182	V97 F100 H102 F104 V143 L150 T153 W154 T157 F174
BS04	BCL	C	I66 R95 I96 S97 V118 H145 W183 H226 S234 A251 Q252 V253	I58 R87 I88 S89 V110 H137 W175 H217 S225 A242 Q243 V244
BS05	BCL	C	P42 S72 V74 N79 L81 F114 F182	P34 S64 V66 N71 L73 F106 F174
BS06	BCL	C	A40 P187 A191 Q197 I292 H296 H297 V300	A32 P179 A183 Q189 I283 H287 H288 V291
BS07	BCL	C	Y15 P39 A40 F257 I264 H297 V300 F306 C352	Y8 P31 A32 F248 I255 H288 V291 F297 C343
BS08	BCL	C	L121 Y123 Y124 R125	L113 Y115 Y116 R117

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis

External links

• PDB: RCSB:3eni, PDBe:3eni, PDBj:3eni
• PDBsum: 3eni
• PubMed: 19437128
• UniProt: Q46393|BCPA_CHLTE Bacteriochlorophyll a protein (Gene Name=fmoA)