Structure of PDB 3ef4 Chain C |
>3ef4C (length=124) Species: 53399 (Hyphomicrobium denitrificans) [Search protein sequence] |
AEHIVEMRNKDDAGNTMVFQPGFVKVEAGDTVKFVPTDKSHNAESVREVW PEGVAPVKGGFSKEVVFNAEKEGLYVLKCAPHYGMGMVVLVQVGKPVNLD QIKEYKATGLAKKRLDGEIAKVVQ |
|
PDB | 3ef4 Atomic resolution structure of pseudoazurin from the methylotrophic denitrifying bacterium Hyphomicrobium denitrificans: structural insights into its spectroscopic properties |
Chain | C |
Resolution | 1.18 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
C |
H41 C79 H82 M87 |
H41 C79 H82 M87 |
|
|
|
|