Structure of PDB 3ebj Chain C

Receptor sequence

>3ebjC (length=176) Species: 93838 (Influenza A virus (A/goose/Guangdong/1/1996(H5N1)))

LGSMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFM
YSHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIG
VTRREVHTYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARI
KTRLFTIRQEMASRGLWDSFRQSERG

3D structure

• PDB: 3ebj Crystal structure of an avian influenza polymerase PA(N) reveals an endonuclease active site
• Chain: C
• Resolution: 2.2 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	C	E80 D108	E59 D87

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0039694 viral RNA genome replication

External links

• PDB: RCSB:3ebj, PDBe:3ebj, PDBj:3ebj
• PDBsum: 3ebj
• PubMed: 19194458
• UniProt: Q9Q0U9|PA_I96A0 Polymerase acidic protein (Gene Name=PA)