Structure of PDB 3e27 Chain C

Receptor sequence
>3e27C (length=189) Species: 1392 (Bacillus anthracis) [Search protein sequence]
MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRDI
TSVESRLQMLELATEAEEHFSICLEELSRKGPSYTYDTMLQLTKKYPDVQ
FHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYKLRTPYPITTVEIP
EFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLYES
3D structure
PDB3e27 Targeting NAD biosynthesis in bacterial pathogens: Structure-based development of inhibitors of nicotinate mononucleotide adenylyltransferase NadD.
ChainC
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 DND C G8 G9 T10 H18 I21 P43 H44 K45 T85 G106 D108 M109 W116 Y117 R133 F152 V154 G8 G9 T10 H18 I21 P43 H44 K45 T85 G106 D108 M109 W116 Y117 R133 F152 V154
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat Nov 16 16:31:56 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3e27', asym_id = 'C', title = 'Targeting NAD biosynthesis in bacterial pathogen...otinate mononucleotide adenylyltransferase NadD. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3e27', asym_id='C', title='Targeting NAD biosynthesis in bacterial pathogen...otinate mononucleotide adenylyltransferase NadD. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003824,0009058,0009435,0016779', uniprot = '', pdbid = '3e27', asym_id = 'C'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003824,0009058,0009435,0016779', uniprot='', pdbid='3e27', asym_id='C')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>