Structure of PDB 3d8f Chain C |
>3d8fC (length=127) Species: 9606 (Homo sapiens) [Search protein sequence] |
GIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKDLLLQLEDET LKLVEPQSQALLHAQPIISIRVWGVGRDSGRERDFAYVARDKLTQMLKCH VFRCEAPAKNIATSLHEICSKIMAELE |
|
PDB | 3d8f Crystal structure of the human Fe65-PTB1 domain. |
Chain | C |
Resolution | 2.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
PO4 |
C |
R451 R470 |
R71 R90 |
|
|
|
|