Structure of PDB 3cog Chain C

Receptor sequence
>3cogC (length=390) Species: 9606 (Homo sapiens) [Search protein sequence]
GFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQGFEYS
RSGNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMD
DVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTN
PTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSAT
KYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKT
LHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCT
GMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLK
NDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHPPS
3D structure
PDB3cog Structural basis for the inhibition mechanism of human cystathionine gamma-lyase, an enzyme responsible for the production of H(2)S.
ChainC
Resolution2.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) R62 Y114 D187 K212
Catalytic site (residue number reindexed from 1) R51 Y103 D176 K201
Enzyme Commision number 4.4.1.1: cystathionine gamma-lyase.
4.4.1.2: homocysteine desulfhydrase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PLP C G90 L91 Y114 D187 T189 S209 T211 K212 G79 L80 Y103 D176 T178 S198 T200 K201
BS02 2AG C Y114 R119 E339 Y103 R108 E328
BS03 PLP C Y60 R62 Y49 R51
BS04 2AG C Y60 R62 Y49 R51
Gene Ontology
Molecular Function
GO:0004123 cystathionine gamma-lyase activity
GO:0005515 protein binding
GO:0005516 calmodulin binding
GO:0016829 lyase activity
GO:0030170 pyridoxal phosphate binding
GO:0042802 identical protein binding
GO:0044540 L-cystine L-cysteine-lyase (deaminating)
GO:0047982 homocysteine desulfhydrase activity
GO:0080146 L-cysteine desulfhydrase activity
GO:0098606 selenocystathionine gamma-lyase activity
Biological Process
GO:0006534 cysteine metabolic process
GO:0006629 lipid metabolic process
GO:0018272 protein-pyridoxal-5-phosphate linkage via peptidyl-N6-pyridoxal phosphate-L-lysine
GO:0019343 cysteine biosynthetic process via cystathionine
GO:0019344 cysteine biosynthetic process
GO:0019346 transsulfuration
GO:0030968 endoplasmic reticulum unfolded protein response
GO:0043066 negative regulation of apoptotic process
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0044524 protein sulfhydration
GO:0051092 positive regulation of NF-kappaB transcription factor activity
GO:0051289 protein homotetramerization
GO:0070814 hydrogen sulfide biosynthetic process
GO:1904831 positive regulation of aortic smooth muscle cell differentiation
GO:1990830 cellular response to leukemia inhibitory factor
GO:2001234 negative regulation of apoptotic signaling pathway
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3cog, PDBe:3cog, PDBj:3cog
PDBsum3cog
PubMed19019829
UniProtP32929|CGL_HUMAN Cystathionine gamma-lyase (Gene Name=CTH)

[Back to BioLiP]