Structure of PDB 3co7 Chain C

Receptor sequence
>3co7C (length=87) Species: 9606 (Homo sapiens) [Search protein sequence]
SRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSN
SSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNP
3D structure
PDB3co7 Structural Basis for DNA Recognition by FoxO1 and Its Regulation by Posttranslational Modification.
ChainC
Resolution2.91 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C L183 R214 H215 S218 R225 S234 S235 W237 L29 R60 H61 S64 R71 S80 S81 W83 PDBbind-CN: Kd=12nM
BS02 dna C R157 S164 Y165 N211 H215 G232 R3 S10 Y11 N57 H61 G78 PDBbind-CN: Kd=12nM
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3co7, PDBe:3co7, PDBj:3co7
PDBsum3co7
PubMed18786403
UniProtQ12778|FOXO1_HUMAN Forkhead box protein O1 (Gene Name=FOXO1)

[Back to BioLiP]