Structure of PDB 3cnx Chain C |
>3cnxC (length=148) Species: 33903 (Streptomyces avermitilis) [Search protein sequence] |
TPDTDVEQVGLANTAFYEAMERGDFETLSSLWLTPADLGVDPADAGVVSC VHPGWPVLSGRGEVLRSYALIMANTEYIQFFLTDVHVSVTGDTALVTCTE NILSGGPPPDDSDELGPLVGQLVVATNVFRRTPDGWKLWSHHASPVLA |
|
PDB | 3cnx Crystal structure of NTF2-like protein of unknown function (NP_825848.1) from Streptomyces avermitilis at 2.10 A resolution |
Chain | C |
Resolution | 2.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
C |
E25 F89 |
E21 F80 |
|
|
|
|