Structure of PDB 3c6e Chain C |
>3c6eC (length=81) Species: 11060 (dengue virus type 2) [Search protein sequence] |
FHLTTRNGEPHMIVSRQEKGKSLLFKTEDGVNMCTLMAMDLGELCEDTIT YKCPLLRQNEPEDIDCWCNSTSTWVTYGTCT |
|
PDB | 3c6e The flavivirus precursor membrane-envelope protein complex: structure and maturation. |
Chain | C |
Resolution | 2.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MAN |
C |
H2 T4 |
H2 T4 |
|
|
|
|