Structure of PDB 3bxx Chain C

Receptor sequence

>3bxxC (length=324) Species: 29760 (Vitis vinifera)

ETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAE
THLTLWKADLADEGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTIE
GMLGIMKSCAAAKTVRRLVFTSSAGTVNIQEHQLPVYDESCWSDMEFCRA
KKMTAWMYFVSKTLAEQAAWKYAKENNIDFITIIPTLVVGPFIMSSMPPS
LITALSPITGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKAEGRYICSS
HDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFK
YSLEDMFTGAVDTCRAKGLLPPSH

3D structure

• PDB: 3bxx Structural evidence for the inhibition of grape dihydroflavonol 4-reductase by flavonols
• Chain: C
• Resolution: 2.9 Å

Enzymatic activity

• Enzyme Commision number: 1.1.1.219: dihydroflavanol 4-reductase.
  1.1.1.234: flavanone 4-reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	C	S14 G15 F16 I17 R37 K44 D64 L65 V84 A85 T86 T126 S128 K167 P190 T191 L192 V193 S205	S9 G10 F11 I12 R32 K39 D59 L60 V79 A80 T81 T121 S123 K162 P185 T186 L187 V188 S200
BS02	QUE	C	S128 A129 N133 L192 P204 S205 T208 I222 Q227	S123 A124 N128 L187 P199 S200 T203 I217 Q222
BS03	QUE	C	S128 G130 Y163 F164 P204	S123 G125 Y158 F159 P199

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0045552 dihydrokaempferol 4-reductase activity
• GO:0047890 flavanone 4-reductase activity

Biological Process

• GO:0009718 anthocyanin-containing compound biosynthetic process
• GO:0009813 flavonoid biosynthetic process

External links

• PDB: RCSB:3bxx, PDBe:3bxx, PDBj:3bxx
• PDBsum: 3bxx
• PubMed: 18645237
• UniProt: P51110|DFRA_VITVI Dihydroflavonol 4-reductase (Gene Name=DFR)