Structure of PDB 3boy Chain C

Receptor sequence

>3boyC (length=147) Species: 1423 (Bacillus subtilis)

TLHKERRIGRLSVLLLLNEAEESTQVEELERDGWKVCLGKVGSMDAHKVI
AAIETASKKSGVIQSEGYRESHALYHATMEALHGVTRGEMLLGSLLRTVG
LRFAVLRGNPYESEAEGDWIAVSLYGTIGAPIKGLEHETFGVGINHI

3D structure

• PDB: 3boy Crystal Structure of Activated HutP: An RNA Binding Protein that Regulates Transcription of the hut Operon in Bacillus subtilis
• Chain: C
• Resolution: 1.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	K41 G43 S44 A52 A53 E55 T56 A57 K60 T99 V100 G101 L102 R103 T128 A131 P132 I133 K134 E137	K40 G42 S43 A51 A52 E54 T55 A56 K59 T98 V99 G100 L101 R102 T127 A130 P131 I132 K133 E136
BS02	HIS	C	Y69 H73 Y76 H77	Y68 H72 Y75 H76
BS03	HIS	C	R88 R98 G130 A131 H138	R87 R97 G129 A130 H137
BS04	MG	C	H73 H77	H72 H76

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding

Biological Process

• GO:0006547 L-histidine metabolic process
• GO:0010628 positive regulation of gene expression

External links

• PDB: RCSB:3boy, PDBe:3boy, PDBj:3boy
• PDBsum: 3boy
• UniProt: P10943|HUTP_BACSU Hut operon positive regulatory protein (Gene Name=hutP)