Structure of PDB 3az8 Chain C |
>3az8C (length=144) Species: 5833 (Plasmodium falciparum) [Search protein sequence] |
TSIDIEDIKKILPHRYPFLLVDKVIYMQPNKTIIGLKQVSTNEPFFNGHF PQKQIMPGVLQIEALAQLAGILCLKSDDSQKNNLFLFAGVDGVRWKKPVL PGDTLTMQANLISFKSSLGIAKLSGVGYVNGKVVINISEMTFAL |
|
PDB | 3az8 Structural basis for the functional and inhibitory mechanisms of beta-hydroxyacyl-acyl carrier protein dehydratase (FabZ) of Plasmodium falciparum |
Chain | C |
Resolution | 3.1 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
S21 |
C |
H133 G142 W179 |
H49 G58 W95 |
PDBbind-CN: -logKd/Ki=6.00,Kd~1uM |
|
|
|