Structure of PDB 3akm Chain C

Receptor sequence
>3akmC (length=131) Species: 9606 (Homo sapiens) [Search protein sequence]
AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVK
ESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGN
ELNTVREIIGDELVQTYVYEGVEAKRIFKKD
3D structure
PDB3akm Crystal structures of human and rat intestinal fatty acid binding proteins in complex with 11-(Dansylamino)undecanoic acid
ChainC
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 11D C Y14 F17 V23 K27 A31 V49 E51 Y70 L72 D74 W82 L102 R106 Y117 Y14 F17 V23 K27 A31 V49 E51 Y70 L72 D74 W82 L102 R106 Y117 BindingDB: Ki=3e+2nM,Kd=3.6e+2nM
Gene Ontology
Molecular Function
GO:0005324 long-chain fatty acid transmembrane transporter activity
GO:0005504 fatty acid binding
GO:0005515 protein binding
GO:0008289 lipid binding
GO:0036041 long-chain fatty acid binding
Biological Process
GO:0006631 fatty acid metabolic process
GO:0015908 fatty acid transport
GO:0015909 long-chain fatty acid transport
GO:0050892 intestinal absorption
GO:0098856 intestinal lipid absorption
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005902 microvillus
GO:0045179 apical cortex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3akm, PDBe:3akm, PDBj:3akm
PDBsum3akm
PubMed
UniProtP12104|FABPI_HUMAN Fatty acid-binding protein, intestinal (Gene Name=FABP2)

[Back to BioLiP]