Structure of PDB 3ab3 Chain C

Receptor sequence

>3ab3C (length=318) Species: 10090 (Mus musculus)

RLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGM
RVLVDAREKLHIPWGDNKNQLHGDKLMAFDTRAPMAAQGMVETRVFLQYL
PAIRALWEDSGIQNAYDRRREFQLGESVKYFLDNLDKLGVPDYIPSQQDI
LLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFL
VSSSEFDQVLMEDRQTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLL
EEKVQVVSIKDYFLEFEGDPHCLRDVQKFLVECFRGKRRDPLYHHFTTAI
NTENIRLVFRDVKDTILH

3D structure

• PDB: 3ab3 Identification of critical residues in G(alpha)13 for stimulation of p115RhoGEF activity and the structure of the G(alpha)13-p115RhoGEF regulator of G protein signaling homology (RH) domain complex.
• Chain: C
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E58 T63 R200 D222 Q226
• Catalytic site (residue number reindexed from 1): E12 T17 R154 D176 Q180

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	C	S62 T203	S16 T157
BS02	GDP	C	E58 S59 G60 K61 S62 T63 L198 R200 N291 K292 D294 L295 T348 I350	E12 S13 G14 K15 S16 T17 L152 R154 N245 K246 D248 L249 T298 I300
BS03	ALF	C	G57 K61 R200 P202 T203 G224 G225 Q226	G11 K15 R154 P156 T157 G178 G179 Q180

Gene Ontology

Molecular Function

• GO:0001664 G protein-coupled receptor binding
• GO:0003924 GTPase activity
• GO:0019001 guanyl nucleotide binding
• GO:0031683 G-protein beta/gamma-subunit complex binding

Biological Process

• GO:0007165 signal transduction
• GO:0007186 G protein-coupled receptor signaling pathway
• GO:0007266 Rho protein signal transduction

External links

• PDB: RCSB:3ab3, PDBe:3ab3, PDBj:3ab3
• PDBsum: 3ab3
• PubMed: 21507947
• UniProt: P27601|GNA13_MOUSE Guanine nucleotide-binding protein subunit alpha-13 (Gene Name=Gna13)