Structure of PDB 3a6p Chain C

Receptor sequence
>3a6pC (length=170) Species: 9615 (Canis lupus familiaris) [Search protein sequence]
PQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNR
GPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHR
DLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYN
FEKPFLWLARKLIGDPNLEF
3D structure
PDB3a6p A high-resolution structure of the pre-microRNA nuclear export machinery
ChainC
Resolution2.92 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GTP C G19 G20 G22 K23 T24 T25 F35 K37 Y39 T42 N122 K123 D125 I126 A151 G13 G14 G16 K17 T18 T19 F29 K31 Y33 T36 N116 K117 D119 I120 A145
BS02 MG C T24 T42 D65 T18 T36 D59
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003924 GTPase activity
GO:0005049 nuclear export signal receptor activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
GO:0070883 pre-miRNA binding
GO:1905172 RISC complex binding
Biological Process
GO:0000054 ribosomal subunit export from nucleus
GO:0000070 mitotic sister chromatid segregation
GO:0006606 protein import into nucleus
GO:0006611 protein export from nucleus
GO:0006913 nucleocytoplasmic transport
GO:0015031 protein transport
GO:0035281 pre-miRNA export from nucleus
GO:0046039 GTP metabolic process
GO:0046827 positive regulation of protein export from nucleus
GO:0051301 cell division
GO:0061015 snRNA import into nucleus
Cellular Component
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016442 RISC complex
GO:0032991 protein-containing complex
GO:0042470 melanosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3a6p, PDBe:3a6p, PDBj:3a6p
PDBsum3a6p
PubMed19965479
UniProtP62825|RAN_CANLF GTP-binding nuclear protein Ran (Gene Name=RAN)

[Back to BioLiP]