Structure of PDB 2zvs Chain C

Receptor sequence
>2zvsC (length=80) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
ALLITKKCINCDMCEPECPNEAISMGDHIYEINSDKCTECVGHYETPTCQ
KVCPIPNTIVKDPAHVETEEQLWDKFVLMH
3D structure
PDB2zvs Insight into the protein and solvent contributions to the reduction potentials of [4Fe-4S]2+/+ clusters: crystal structures of the Allochromatium vinosum ferredoxin variants C57A and V13G and the homologous Escherichia coli ferredoxin
ChainC
Resolution1.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 C I4 C8 I9 N10 C11 C14 Y30 C53 N57 I4 C8 I9 N10 C11 C14 Y30 C53 N57
BS02 SF4 C L2 C18 P19 A22 I32 C37 E39 C40 C49 L2 C18 P19 A22 I32 C37 E39 C40 C49
Gene Ontology
Molecular Function
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0002097 tRNA wobble base modification
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2zvs, PDBe:2zvs, PDBj:2zvs
PDBsum2zvs
PubMed19290553
UniProtP52102|YFHL_ECOLI Ferredoxin YfhL (Gene Name=yfhL)

[Back to BioLiP]