Structure of PDB 2zjq Chain C

Receptor sequence

>2zjqC (length=197) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]

AQINVIGQNGGRTIELPLPEVNSGVLHEVVTWQLASRRRGTASTRTRAQV
SKTGRKMYGQKGTGNARHGDRSVPTFVGGGVAFGPKPRSYDYTLPRQVRQ
LGLAMAIASRQEGGKLVAVDGFDIADAKTKNFISWAKQNGLDGTEKVLLV
TDDENTRRAARNVSWVSVLPVAGVNVYDILRHDRLVIDAAALEIVEE

3D structure

PDB

2zjq Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	H28 Q34 L35 R39 R40 T42 S44 T45 R46 R48 Q50 R56 Q61 K62 G63 N66 A67 R68 H69 G70 P75 T76 F77 V78 F84 P86 P88 R89 Y91 Y93 T94 P96 R97 Q98 R100 A128 K129 T130 I134 K147 R159 R162 V164 N176 Y178	H27 Q33 L34 R38 R39 T41 S43 T44 R45 R47 Q49 R55 Q60 K61 G62 N65 A66 R67 H68 G69 P74 T75 F76 V77 F83 P85 P87 R88 Y90 Y92 T93 P95 R96 Q97 R99 A127 K128 T129 I133 K146 R158 R161 V163 N175 Y177

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2zjq, PDBe:2zjq, PDBj:2zjq
PDBsum	2zjq
PubMed	18406324
UniProt	Q9RXK1\|RL4_DEIRA Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]