Structure of PDB 2zfo Chain C

Receptor sequence

>2zfoC (length=147) Species: 55676 (Oligobrachia mashikoi)

SSCCSSEDRANVMHNWDAAWSAAYSDRRVALAQAVFASLFSRDAAAQGLF
SGVSADNPDSADFRAHCVRVVNGLDVAINMLNDPAVLNEQLAHLSAQHQA
RAGVAAAHFDVMAEAFAEVMPQVSSCFSSDSWNRCFARIANGISAGL

3D structure

• PDB: 2zfo Structure of the partially unliganded met state of 400 kDa hemoglobin: insights into ligand-induced structural changes of giant hemoglobins
• Chain: C
• Resolution: 1.95 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	L49 F50 V53 R69 V70 L74 Q97 H98 R101 H108 F109 M112	L49 F50 V53 R69 V70 L74 Q97 H98 R101 H108 F109 M112

Gene Ontology

Molecular Function

• GO:0005344 oxygen carrier activity
• GO:0005506 iron ion binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0001666 response to hypoxia
• GO:0015671 oxygen transport

Cellular Component

• GO:0005576 extracellular region
• GO:0005833 hemoglobin complex

External links

• PDB: RCSB:2zfo, PDBe:2zfo, PDBj:2zfo
• PDBsum: 2zfo
• PubMed: 18398907
• UniProt: Q7M418|GLBB2_OLIMA Extracellular giant hemoglobin major globin subunit B2 (Gene Name=ghbB2)