Structure of PDB 2z7c Chain C |
>2z7cC (length=89) Species: 53953 (Pyrococcus horikoshii) [Search protein sequence] |
HVVYIGKKPVMNYVLAVITQFHEGAKEVSIKARGRAISRAVDVAEIVRNR FLKDDVDVKEIKIGTEELPTADGRTTNTSTIEIVLARKT |
|
PDB | 2z7c Crystal structure and functional analysis of an archaeal chromatin protein Alba from the hyperthermophilic archaeon Pyrococcus horikoshii OT3. |
Chain | C |
Resolution | 2.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ARG |
C |
T69 N81 S83 |
T65 N77 S79 |
|
|
|
|