Structure of PDB 2xsd Chain C

Receptor sequence
>2xsdC (length=128) Species: 10090 (Mus musculus) [Search protein sequence]
APSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEA
LQLSFKNMCKLKPLLNKWLEETDSIEVGVKGALESHFLKCPKPSAHEITG
LADSLQLEKEVVRVWFCNRRQKEKRMTP
3D structure
PDB2xsd Crystal Structure of the Dimeric Oct6 (POU3F1) POU Domain Bound to Palindromic More DNA.
ChainC
Resolution2.049 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C Q288 T289 C292 Q298 S343 I344 N387 Q42 T43 C46 Q52 S74 I75 N118
BS02 dna C F286 S287 T289 T290 R293 S300 N303 K361 R382 C386 R389 Q390 K393 F40 S41 T43 T44 R47 S54 N57 K92 R113 C117 R120 Q121 K124
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2xsd, PDBe:2xsd, PDBj:2xsd
PDBsum2xsd
PubMed21117060
UniProtP21952|PO3F1_MOUSE POU domain, class 3, transcription factor 1 (Gene Name=Pou3f1)

[Back to BioLiP]