Structure of PDB 2xkv Chain C

Receptor sequence
>2xkvC (length=43) Species: 562 (Escherichia coli) [Search protein sequence]
KVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGSGMQVQDV
3D structure
PDB2xkv Cryo-Em Structure of the E. Coli Translating Ribosome in Complex with Srp and its Receptor.
ChainC
Resolution13.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.4: signal-recognition-particle GTPase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna C A30 N33 M35 T36 K38 S49 R50 R53 G57 S58 G59 A8 N11 M13 T14 K16 S27 R28 R31 G35 S36 G37
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005525 GTP binding
GO:0008312 7S RNA binding
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Cellular Component
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2xkv, PDBe:2xkv, PDBj:2xkv
PDBsum2xkv
PubMed21151118
UniProtP0AGD7|SRP54_ECOLI Signal recognition particle protein (Gene Name=ffh)

[Back to BioLiP]