Structure of PDB 2xjz Chain C

Receptor sequence

>2xjzC (length=112) Species: 9606 (Homo sapiens) [Search protein sequence]

GGCQQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGL
CASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIV
CEQDIYEWTKIN

3D structure

PDB

2xjz Structure of the Leukemia Oncogene Lmo2: Implications for the Assembly of a Hematopoietic Transcription Factor Complex.

Chain

Resolution

2.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	C	R63 L64 Y65 Y66 K67 Y77 Q83 G85 I94 A96 Y97 E98 M99 T100 M101 R102 C123 V124 G125 D126 R127 Y128 L129	R27 L28 Y29 Y30 K31 Y41 Q47 G49 I58 A60 Y61 E62 M63 T64 M65 R66 C87 V88 G89 D90 R91 Y92 L93
BS02	ZN	C	C115 C118 C137 D140	C79 C82 C101 D104
BS03	ZN	C	C87 C90 H109 C112	C51 C54 H73 C76
BS04	ZN	C	C50 C53 C73 D76	C14 C17 C37 D40

External links

PDB	RCSB:2xjz, PDBe:2xjz, PDBj:2xjz
PDBsum	2xjz
PubMed	21076045
UniProt	P25791\|RBTN2_HUMAN Rhombotin-2 (Gene Name=LMO2)