Structure of PDB 2x7n Chain C |
>2x7nC (length=132) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] |
AQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLG DMVMATVKKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGVIANP KGEMKGSAITGPVGKECADLWPRVASNSGVVV |
|
PDB | 2x7n Mechanism of Eif6-Mediated Inhibition of Ribosomal Subunit Joining. |
Chain | C |
Resolution | 11.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
C |
A1 Q2 R7 |
A1 Q2 R7 |
|
|
|
|