Structure of PDB 2wwz Chain C

Receptor sequence

>2wwzC (length=32) Species: 9606 (Homo sapiens)

DDEGAQWNCTACTFLNHPALIRCEQCEMPRHF

3D structure

• PDB: 2wwz Two-Sided Ubiquitin Binding Explains Specificity of the Tab2 Nzf Domain
• Chain: C
• Resolution: 1.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	C	C670 C673 C684 C687	C9 C12 C23 C26

External links

• PDB: RCSB:2wwz, PDBe:2wwz, PDBj:2wwz
• PDBsum: 2wwz
• PubMed: 19935683
• UniProt: Q9NYJ8|TAB2_HUMAN TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 (Gene Name=TAB2)