Structure of PDB 2wwh Chain C

Receptor sequence

>2wwhC (length=210) Species: 36329 (Plasmodium falciparum 3D7)

MTDDKKKGKFIVFEGLDRSGKSTQSKLLVEYLKNNNVEVKHLYFPNRETG
IGQIISKYLKMENSMSNETIHLLFSANRWEHMNEIKSLLLKGIWVVCDRY
AYSGVAYSSGALNLNKTWCMNPDQGLIKPDVVFYLNVPPNYAQNRSDYGE
EIYEKVETQKKIYETYKHFAHEDYWINIDATRKIEDIHNDIVKEVTKIKV
EPEEFNFLWS

3D structure

• PDB: 2wwh Structural Basis for the Efficient Phosphorylation of Aztmp and Dgmp by Plasmodium Falciparum Type I Thymidylate Kinase.
• Chain: C
• Resolution: 2.7 Å

Enzymatic activity

• Enzyme Commision number: 2.7.4.8: guanylate kinase.
  2.7.4.9: dTMP kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	T5A	C	D17 R18 G20 K21 S22 T23 F44 P45 R47 L59 F74 R78 R99 G104 Y107 R145 R182 I184	D17 R18 G20 K21 S22 T23 F44 P45 R47 L59 F74 R78 R99 G104 Y107 R145 R182 I184

Gene Ontology

Molecular Function

• GO:0004385 guanylate kinase activity
• GO:0004550 nucleoside diphosphate kinase activity
• GO:0004798 thymidylate kinase activity
• GO:0005524 ATP binding
• GO:0016301 kinase activity
• GO:0050316 T2-induced deoxynucleotide kinase activity

Biological Process

• GO:0006177 GMP biosynthetic process
• GO:0006227 dUDP biosynthetic process
• GO:0006233 dTDP biosynthetic process
• GO:0006235 dTTP biosynthetic process
• GO:0009165 nucleotide biosynthetic process
• GO:0016310 phosphorylation
• GO:0046710 GDP metabolic process
• GO:0046940 nucleoside monophosphate phosphorylation

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion

External links

• PDB: RCSB:2wwh, PDBe:2wwh, PDBj:2wwh
• PDBsum: 2wwh
• PubMed: 20353400
• UniProt: Q8I4S1|KTHY_PLAF7 Thymidylate kinase (Gene Name=TMK)