Structure of PDB 2wse Chain C

Receptor sequence
>2wseC (length=81) Species: 3888 (Pisum sativum) [Search protein sequence]
MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVG
CKRCESACPTDFLSVRVYLWHETTRSMGLAY
3D structure
PDB2wse Structure determination and improved model of plant photosystem I
ChainC
Resolution3.49 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.97.1.12: photosystem I.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 C C21 D24 V49 G50 C51 K52 C54 C21 D24 V49 G50 C51 K52 C54
BS02 SF4 C D9 C11 I12 G13 V18 C58 P59 D9 C11 I12 G13 V18 C58 P59
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0009773 photosynthetic electron transport in photosystem I
GO:0015979 photosynthesis
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009534 chloroplast thylakoid
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2wse, PDBe:2wse, PDBj:2wse
PDBsum2wse
PubMed19923216
UniProtP10793|PSAC_PEA Photosystem I iron-sulfur center (Gene Name=psaC)

[Back to BioLiP]