Structure of PDB 2wqj Chain C

Receptor sequence
>2wqjC (length=32) Species: 9606 (Homo sapiens) [Search protein sequence]
GSDEDTYYLQVRGRENFEILMKLKESLELMEL
3D structure
PDB2wqj Structural Evolution of P53, P63, and P73: Implication for Heterotetramer Formation.
ChainC
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide C D353 T354 Y355 Y356 L357 Q358 V359 R360 G361 R362 N364 F365 L368 K372 E379 L380 D5 T6 Y7 Y8 L9 Q10 V11 R12 G13 R14 N16 F17 L20 K24 E31 L32
BS02 peptide C I367 K370 E373 S374 I19 K22 E25 S26
BS03 peptide C Y355 Q358 Y7 Q10
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006915 apoptotic process
GO:0051262 protein tetramerization
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2wqj, PDBe:2wqj, PDBj:2wqj
PDBsum2wqj
PubMed19815500
UniProtO15350|P73_HUMAN Tumor protein p73 (Gene Name=TP73)

[Back to BioLiP]