Structure of PDB 2wow Chain C

Receptor sequence

>2wowC (length=491) Species: 185431 (Trypanosoma brucei brucei TREU927) [Search protein sequence]

SHMSKAFDLVVIGAGSGGLEAGWNAATLYGKRVAVVDVQTSHGPPFYAAL
GGTCVNVGCVPKKLMVTGAQYMDHLRESAGFGWEFDGSSVKANWKKLIAA
KNEAVLDINKSYEGMFNDTEGLDFFLGWGSLESKNVVVVRETADPKSAVK
ERLQADHILLATGSWPQMPAIPGIEHCISSNEAFYLPEPPRRVLTVGGGF
ISVEFAGIFNAYKPPGGKVTLCYRNNLILRGFDETIREEVTKQLTANGIE
IMTNENPAKVSLNTDGSKHVTFESGKTLDVDVVMMAIGRIPRTNDLQLGN
VGVKLTPKGGVQVDEFSRTNVPNIYAIGDITDRLMLTPVAINEGAALVDT
VFGNKPRKTDHTRVASAVFSIPPIGTCGLIEEVAAKEFEKVAVYMSSFTP
LMHNISGSKYKKFVAKIVTNHSDGTVLGVHLLGDGAPEIIQAVGVCLRLN
AKISDFYNTIGVHPTSAEELCSMRTPSYYYVKGEKMEKLPD

3D structure

PDB

2wow Dihydroquinazolines as a Novel Class of Trypanosoma Brucei Trypanothione Reductase Inhibitors: Discovery, Synthesis, and Characterization of Their Binding Mode by Protein Crystallography.

Chain

Resolution

2.2 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	S14 L48 C52 C57 K60 G85 S86 F198 E202 I339 G459 H461 E466 E485 K486
Catalytic site (residue number reindexed from 1)	S16 L50 C54 C59 K62 G87 S88 F200 E204 I341 G461 H463 E468 E487 K488
Enzyme Commision number	1.8.1.12: trypanothione-disulfide reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	FAD	C	I10 G11 G13 S14 G15 D35 V36 A46 G50 T51 V55 G56 C57 K60 W126 G127 T160 G161 R287 R290 G326 D327 M333 L334 T335 A338	I12 G13 G15 S16 G17 D37 V38 A48 G52 T53 V57 G58 C59 K62 W128 G129 T162 G163 R289 R292 G328 D329 M335 L336 T337 A340
BS02	NDP	C	K60 G196 G197 F198 I199 E202 Y221 R222 R228 I285 G286 M333 A365	K62 G198 G199 F200 I201 E204 Y223 R224 R230 I287 G288 M335 A367
BS03	GCG	C	S14 L17 E18 W21 C52 V53 Y110 I339	S16 L19 E20 W23 C54 V55 Y112 I341
BS04	GCG	C	M393 S394 S395 F396 H461 E467 S470	M395 S396 S397 F398 H463 E469 S472

Gene Ontology

	Molecular Function
GO:0000166	nucleotide binding
GO:0004791	thioredoxin-disulfide reductase (NADPH) activity
GO:0015036	disulfide oxidoreductase activity
GO:0015042	trypanothione-disulfide reductase (NADPH) activity
GO:0016491	oxidoreductase activity
GO:0016668	oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor
GO:0046872	metal ion binding
GO:0050660	flavin adenine dinucleotide binding

	Biological Process
GO:0045454	cell redox homeostasis
GO:0098869	cellular oxidant detoxification

	Cellular Component
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0020015	glycosome
GO:0097014	ciliary plasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2wow, PDBe:2wow, PDBj:2wow
PDBsum	2wow
PubMed	21851087
UniProt	Q389T8

[Back to BioLiP]