Structure of PDB 2wo8 Chain C

Receptor sequence
>2wo8C (length=163) Species: 9606 (Homo sapiens) [Search protein sequence]
MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINT
GMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWT
THSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADD
IRGIQSLYGDPKE
3D structure
PDB2wo8 The Identification of Beta-Hydroxy Carboxylic Acids as Selective Mmp-12 Inhibitors.
ChainC
Resolution2.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H218 E219 H222 H228
Catalytic site (residue number reindexed from 1) H114 E115 H118 H124
Enzyme Commision number 3.4.24.65: macrophage elastase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN C H218 H222 H228 H114 H118 H124
BS02 ZN C H168 D170 H183 H196 H64 D66 H79 H92
BS03 CA C D175 G176 G178 I180 D198 E201 D71 G72 G74 I76 D94 E97
BS04 077 C L181 A182 T215 H218 E219 H228 V235 T239 Y240 L77 A78 T111 H114 E115 H124 V131 T135 Y136 MOAD: ic50=0.52uM
BindingDB: IC50=520nM
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0031012 extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2wo8, PDBe:2wo8, PDBj:2wo8
PDBsum2wo8
PubMed19703773
UniProtP39900|MMP12_HUMAN Macrophage metalloelastase (Gene Name=MMP12)

[Back to BioLiP]