Structure of PDB 2wn2 Chain C

Receptor sequence
>2wn2C (length=253) Species: 366501 (Dictyostelium discoideum AX2) [Search protein sequence]
MSTQGLVQLLANAQCHLRTSTNYNGVHTQFNSALNYKNNGTNTIDGSEAW
CSSIVDTNQYIVAGCEVPRTFMCVALQGRGDADQWVTSYKIRYSLDNVSW
FEYRNGAAVTGVTDRNTVVNHFFDTPIRARSIAIHPLTWNGHISLRCEFY
TQPVQSSVTQVGADIYTGDNCALNTGSGKREVVVPVKFQFEFATLPKVAL
NFDQIDCTDATNQTRIGVQPRNITTKGFDCVFYTWNENKVYSLRADYIAT
ALE
3D structure
PDB2wn2 Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
ChainC
Resolution1.82 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GAL C Y166 D206 Y241 S242 Y166 D206 Y241 S242
BS02 CA C D164 D203 D246 D164 D203 D246
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0030246 carbohydrate binding
GO:0030247 polysaccharide binding
GO:0046871 N-acetylgalactosamine binding
GO:0070492 oligosaccharide binding
GO:1990458 lipooligosaccharide binding
Biological Process
GO:0000281 mitotic cytokinesis
GO:0007010 cytoskeleton organization
GO:0007155 cell adhesion
GO:0009617 response to bacterium
GO:0010468 regulation of gene expression
GO:0019954 asexual reproduction
GO:0030865 cortical cytoskeleton organization
GO:0031589 cell-substrate adhesion
GO:0061635 regulation of protein complex stability
GO:0072697 protein localization to cell cortex
GO:0098609 cell-cell adhesion
GO:0106136 lectin-induced modified bacterial internalization
GO:1902168 response to catechin
GO:1904643 response to curcumin
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005938 cell cortex
GO:0009986 cell surface
GO:0031012 extracellular matrix
GO:0045335 phagocytic vesicle
GO:0097708 intracellular vesicle
GO:0098636 protein complex involved in cell adhesion
GO:0106139 symbiont cell surface

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2wn2, PDBe:2wn2, PDBj:2wn2
PDBsum2wn2
PubMed20580724
UniProtP02886|DIS1A_DICDI Discoidin-1 subunit A (Gene Name=dscA-1)

[Back to BioLiP]