Structure of PDB 2we5 Chain C

Receptor sequence

>2we5C (length=309) Species: 1351 (Enterococcus faecalis)

GKKMVVALGGNAILSNDASAHAQQQALVQTSAYLVHLIKQGHRLIVSHGN
GPQVGNLLLQQQAADSEKNPAMPLDTCVAMTQGSIGYWLSNALNQELNKA
GIKKQVATVLTQVVVDPADEAFKNPTKPIGPFLTEAEAKEAMQAGAIFKE
DAGRGWRKVVPSPKPIDIHEAETINTLIKNDIITISCGGGGIPVVGQELK
GVEAVIDKDFASEKLAELVDADALVILTGVDYVCINYGKPDEKQLTNVTV
AELEEYKQAGHFAPGSMLPKIEAAIQFVESQPNKQAIITSLENLGSMSGD
EIVGTVVTK

3D structure

• PDB: 2we5 Substrate Binding and Catalysis in Carbamate Kinase Ascertained by Crystallographic and Site- Directed Mutagenesis Studies. Movements and Significance of a Unique Globular Subdomain of This Key Enzyme for Fermentative ATP Production in Bacteria.
• Chain: C
• Resolution: 1.39 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): G11 N12 K128 K209 K271
• Catalytic site (residue number reindexed from 1): G10 N11 K127 K208 K270
• Enzyme Commision number: 2.7.2.2: carbamate kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	C	G11 T229 G230 V231 C235 Y238 S267 M268 K271	G10 T228 G229 V230 C234 Y237 S266 M267 K270

Gene Ontology

Molecular Function

• GO:0005524 ATP binding
• GO:0008804 carbamate kinase activity
• GO:0016301 kinase activity

Biological Process

• GO:0006525 arginine metabolic process
• GO:0016310 phosphorylation
• GO:0019546 arginine deiminase pathway

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:2we5, PDBe:2we5, PDBj:2we5
• PDBsum: 2we5
• PubMed: 20188742
• UniProt: P0A2X7|ARCC1_ENTFA Carbamate kinase 1 (Gene Name=arcC1)