Structure of PDB 2w0f Chain C |
>2w0fC (length=102) Species: 1916 (Streptomyces lividans) [Search protein sequence] |
ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVET ATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERR GH |
|
PDB | 2w0f Structures of Kcsa in Complex with Symmetrical Quaternary Ammonium Compounds Reveal a Hydrophobic Binding Site. |
Chain | C |
Resolution | 2.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
HX0 |
C |
A73 T74 G99 F103 |
A51 T52 G77 F81 |
|
|
|
|