Structure of PDB 2vyn Chain C

Receptor sequence

>2vynC (length=330) Species: 469008 (Escherichia coli BL21(DE3))

TIKVGINGFGRIGRIVFRAAQKRSDIEIVAINDLLDADYMAYMLKYDSTH
GRFDGTVEVKDGHLIVNGKKIRVTAERDPANLKWDEVGVDVVAEATGLFL
TDETARKHITAGAKKVVMTGPSKDNTPMFVKGANFDKYAGQDIVSNASCT
TNCLAPLAKVINDNFGIIEGLMTTVHATTATQKTVDGPSHKDWRGGRGAS
QNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPTPNVSVVDLTVRLEKAA
TYEQIKAAVKAAAEGEMKGVLGYTEDDVVSTDFNGEVCTSVFDAKAGIAL
NDNFVKLVSWYDNETGYSNKVLDLIAHISK

3D structure

• PDB: 2vyn Structure of Insoluble Rat Sperm Glyceraldehyde-3-Phosphate Dehydrogenase (Gapdh) Via Heterotetramer Formation with Escherichia Coli Gapdh Reveals Target for Contraceptive Design.
• Chain: C
• Resolution: 2.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C148 H175
• Catalytic site (residue number reindexed from 1): C149 H176
• Enzyme Commision number: 1.2.1.12: glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	C	G7 G9 R10 I11 D32 L33 T95 G96 L97 F98 T118 A148 A179 N312 Y316	G8 G10 R11 I12 D33 L34 T96 G97 L98 F99 T119 A149 A180 N313 Y317

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
• GO:0005515 protein binding
• GO:0016491 oxidoreductase activity
• GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
• GO:0042802 identical protein binding
• GO:0050661 NADP binding
• GO:0051287 NAD binding

Biological Process

• GO:0006006 glucose metabolic process
• GO:0006096 glycolytic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0016020 membrane

External links

• PDB: RCSB:2vyn, PDBe:2vyn, PDBj:2vyn
• PDBsum: 2vyn
• PubMed: 19542219
• UniProt: P0A9B2|G3P1_ECOLI Glyceraldehyde-3-phosphate dehydrogenase A (Gene Name=gapA)